PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000139-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 345aa    MW: 39303.2 Da    PI: 6.7035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000139-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161460147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W+ +Ed+ll+++++ +G g+W+  +++ g++R++k+c++rw +y
    NNU_000139-RA 14 RGAWSVDEDLLLLNYIQIHGEGRWRELPQRAGLNRCGKSCRLRWMNY 60
                     89********************************************9 PP

2Myb_DNA-binding51.32.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eEd+l+++ +k+ G++ W++Ia +++ gRt++++k++w+++l
    NNU_000139-RA  67 RGNFSMEEDDLIIKMHKLIGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-22564IPR009057Homeodomain-like
PROSITE profilePS5129417.553961IPR017930Myb domain
SuperFamilySSF466898.2E-3012108IPR009057Homeodomain-like
SMARTSM007176.6E-141363IPR001005SANT/Myb domain
PfamPF002493.5E-151460IPR001005SANT/Myb domain
CDDcd001672.05E-101661No hitNo description
PROSITE profilePS5129424.84862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2565116IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002491.1E-1467112IPR001005SANT/Myb domain
CDDcd001675.23E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVRKQCCVKE QVKRGAWSVD EDLLLLNYIQ IHGEGRWREL PQRAGLNRCG KSCRLRWMNY  60
VKPGIKRGNF SMEEDDLIIK MHKLIGNRWS LIAGRLPGRT DNEIKNYWNS HLIKKLQAEQ  120
QKRLVESKEK KPMKNSYIVQ PEAKRRCIQV FLPQQEGKEG NEKIQIIGGT TRDFNKPSSS  180
SSQNVDGPSD LLMDFNVDDL LISDISSSNF LHVHGDRNQQ IKDVSDGDDV RNNLSSHSIF  240
DHSSQKVDDP SDLIMDFTVD DLPISDISSS NLLHVHRGDK IQHITDATYG DGVRNNFSSG  300
SSTFGYSLSS HDILHEGLTN ETMVQDLYHP LQSDEVLNSI GWPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-24311616128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274708.13e-79PREDICTED: transcription repressor MYB6-like
TrEMBLA0A059CUV15e-67A0A059CUV1_EUCGR; Uncharacterized protein
STRINGVIT_11s0016g01300.t012e-64(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-57myb domain protein 5